ING2 (NM_001564) Human Mass Spec Standard
CAT#: PH302478
ING2 MS Standard C13 and N15-labeled recombinant protein (NP_001555)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202478 |
Predicted MW | 32.8 kDa |
Protein Sequence |
>RC202478 protein sequence
Red=Cloning site Green=Tags(s) MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKY KKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKM DSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPN EPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001555 |
RefSeq Size | 2465 |
RefSeq ORF | 840 |
Synonyms | ING1L; p33ING2 |
Locus ID | 3622 |
UniProt ID | Q9H160, B2RA15 |
Cytogenetics | 4q35.1 |
Summary | 'This gene is a member of the inhibitor of growth (ING) family. Members of the ING family associate with and modulate the activity of histone acetyltransferase (HAT) and histone deacetylase (HDAC) complexes and function in DNA repair and apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]' |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419856 | ING2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419856 | Transient overexpression lysate of inhibitor of growth family, member 2 (ING2) |
USD 396.00 |
|
TP302478 | Recombinant protein of human inhibitor of growth family, member 2 (ING2) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review