ING2 (NM_001564) Human Mass Spec Standard

CAT#: PH302478

ING2 MS Standard C13 and N15-labeled recombinant protein (NP_001555)

Product Images

Coomassie blue staining of purified ING2 protein (Cat# TP302478). The protein was produced from HEK293T cells transfected with ING2 cDNA clone (Cat# RC202478) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202478
• Predicted MW: 32.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202478 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKY
  KKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKM
  DSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPN
  EPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001555
• RefSeq Size: 2465
• RefSeq ORF: 840
• Synonyms: ING1L; p33ING2
• Locus ID: 3622
• UniProt ID: Q9H160, B2RA15
• Cytogenetics: 4q35.1
• Summary: 'This gene is a member of the inhibitor of growth (ING) family. Members of the ING family associate with and modulate the activity of histone acetyltransferase (HAT) and histone deacetylase (HDAC) complexes and function in DNA repair and apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]'
• Protein Families: Druggable Genome, Transcription Factors