PIN1 (NM_006221) Human Mass Spec Standard
CAT#: PH302543
PIN1 MS Standard C13 and N15-labeled recombinant protein (NP_006212)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202543 |
| Predicted MW | 18.2 kDa |
| Protein Sequence |
>RC202543 protein sequence
Red=Cloning site Green=Tags(s) MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA LRTGEMSGPVFTDSGIHIILRTE myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_006212 |
| RefSeq Size | 1138 |
| RefSeq ORF | 489 |
| Synonyms | DOD; UBL5 |
| Locus ID | 5300 |
| UniProt ID | Q13526 |
| Cytogenetics | 19p13.2 |
| Summary | 'Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011]' |
| Protein Families | Druggable Genome |
| Protein Pathways | RIG-I-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401873 | PIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401873 | Transient overexpression lysate of peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1) |
USD 436.00 |
|
| TP302543 | Recombinant protein of human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China