TTC11 (FIS1) (NM_016068) Human Mass Spec Standard

CAT#: PH302560

FIS1 MS Standard C13 and N15-labeled recombinant protein (NP_057152)

Product Images

Coomassie blue staining of purified FIS1 protein (Cat# TP302560). The protein was produced from HEK293T cells transfected with FIS1 cDNA clone (Cat# RC202560) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202560
• Predicted MW: 16.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202560 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQ
  RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA
  GLIGLAVSKSKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057152
• RefSeq Size: 785
• RefSeq ORF: 456
• Synonyms: CGI-135; TTC11
• Locus ID: 51024
• UniProt ID: Q9Y3D6
• Cytogenetics: 7q22.1
• Summary: The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]). [supplied by OMIM, Mar 2008]
• Protein Families: Transmembrane