C16orf57 (USB1) (NM_024598) Human Mass Spec Standard
CAT#: PH302591
C16orf57 MS Standard C13 and N15-labeled recombinant protein (NP_078874)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202591 |
| Predicted MW | 30.3 kDa |
| Protein Sequence |
>RC202591 protein sequence
Red=Cloning site Green=Tags(s) MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGR VRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQA LKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLS LAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_078874 |
| RefSeq Size | 2287 |
| RefSeq ORF | 795 |
| Synonyms | C16orf57; hUsb1; HVSL1; Mpn1; PN |
| Locus ID | 79650 |
| UniProt ID | Q9BQ65, A0A024R6V6 |
| Cytogenetics | 16q21 |
| Summary | This gene encodes a protein with several conserved domains, however, its exact function is not known. Mutations in this gene are associated with poikiloderma with neutropenia (PN), which shows phenotypic overlap with Rothmund-Thomson syndrome (RTS) caused by mutations in the RECQL4 gene. It is believed that this gene product interacts with RECQL4 protein via SMAD4 proteins, explaining the partial clinical overlap between PN and RTS. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Mar 2011] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411214 | USB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC434095 | USB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY411214 | Transient overexpression lysate of chromosome 16 open reading frame 57 (C16orf57) |
USD 436.00 |
|
| LY434095 | Transient overexpression lysate of chromosome 16 open reading frame 57 (C16orf57), transcript variant 2 |
USD 436.00 |
|
| TP302591 | Recombinant protein of human chromosome 16 open reading frame 57 (C16orf57) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China