CHCHD5 (NM_032309) Human Mass Spec Standard

CAT#: PH302606

CHCHD5 MS Standard C13 and N15-labeled recombinant protein (NP_115685)

Product Images

Coomassie blue staining of purified CHCHD5 protein (Cat# TP302606). The protein was produced from HEK293T cells transfected with CHCHD5 cDNA clone (Cat# RC202606) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202606
• Predicted MW: 12.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202606 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLR
  QNEAAVGNCAEHMRRFLQCAEQVQPPRSPATVEAQPLPAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115685
• RefSeq Size: 698
• RefSeq ORF: 330
• Synonyms: C2orf9; CHTM1; MIC14; MIX14
• Locus ID: 84269
• UniProt ID: Q9BSY4, A0A2U9EWT9
• Cytogenetics: 2q14.1