ABHD3 (NM_138340) Human Mass Spec Standard

CAT#: PH302633

ABHD3 MS Standard C13 and N15-labeled recombinant protein (NP_612213)

Product Images

Coomassie blue staining of purified ABHD3 protein (Cat# TP302633). The protein was produced from HEK293T cells transfected with ABHD3 cDNA clone (Cat# RC202633) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202633
• Predicted MW: 46 kDa
• Protein Sequence:
  Sequence Link

  >RC202633 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQCLAMDLRMLSRELSLYLEHQVRVGFFGSGVGLSLILGFSVAYAFYYLSSIAKKPQLVTGGESFSRFLQ
  DHCPVVTETYYPTVWCWEGRGQTLLRPFITSKPPVQYRNELIKTADGGQISLDWFDNDNSTCYMDASTRP
  TILLLPGLTGTSKESYILHMIHLSEELGYRCVVFNNRGVAGENLLTPRTYCCANTEDLETVIHHVHSLYP
  SAPFLAAGVSMGGMLLLNYLGKIGSKTPLMAAATFSVGWNTFACSESLEKPLNWLLFNYYLTTCLQSSVN
  KHRHMFVKQVDMDHVMKAKSIREFDKRFTSVMFGYQTIDDYYTDASPSPRLKSVGIPVLCLNSVDDVFSP
  SHAIPIETAKQNPNVALVLTSYGGHIGFLEGIWPRQSTYMDRVFKQFVQAMVEHGHELS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612213
• RefSeq Size: 2085
• RefSeq ORF: 1227
• Synonyms: LABH3
• Locus ID: 171586
• UniProt ID: Q8WU67
• Cytogenetics: 18q11.2
• Summary: This gene encodes a protein containing an alpha/beta hydrolase fold, which is a catalytic domain found in a very wide range of enzymes. The function of this protein has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane