Triosephosphate isomerase (TPI1) (NM_000365) Human Mass Spec Standard

CAT#: PH302652

TPI1 MS Standard C13 and N15-labeled recombinant protein (NP_000356)

Product Images

Coomassie blue staining of purified TPI1 protein (Cat# TP302652). The protein was produced from HEK293T cells transfected with TPI1 cDNA clone (Cat# RC202652) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202652
• Predicted MW: 26.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202652 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKV
  TNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGIT
  EKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYG
  GSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000356
• RefSeq Size: 1366
• RefSeq ORF: 747
• Synonyms: HEL-S-49; TIM; TPI; TPID
• Locus ID: 7167
• UniProt ID: P60174, Q53HE2, V9HWK1
• Cytogenetics: 12p13.31
• Summary: 'This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate (G3P) and dihydroxy-acetone phosphate (DHAP) in glycolysis and gluconeogenesis. Mutations in this gene are associated with triosephosphate isomerase deficiency. Pseudogenes have been identified on chromosomes 1, 4, 6 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]'
• Protein Pathways: Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Inositol phosphate metabolism, Metabolic pathways