Kallikrein 2 (KLK2) (NM_005551) Human Mass Spec Standard

CAT#: PH302667

KLK2 MS Standard C13 and N15-labeled recombinant protein (NP_005542)

Product Images

Coomassie blue staining of purified KLK2 protein (Cat# TP302667). The protein was produced from HEK293T cells transfected with KLK2 cDNA clone (Cat# RC202667) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202667
• Predicted MW: 28.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202667 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKN
  SQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLG
  LPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCG
  GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005542
• RefSeq Size: 2855
• RefSeq ORF: 783
• Synonyms: hGK-1; hK2; KLK2A2
• Locus ID: 3817
• UniProt ID: P20151, A0A024R4J4, B4DU77
• Cytogenetics: 19q13.33
• Summary: 'This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Jan 2012]'
• Protein Families: Druggable Genome, Protease