C1D (NM_006333) Human Mass Spec Standard
CAT#: PH302688
C1D MS Standard C13 and N15-labeled recombinant protein (NP_006324)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202688 |
Predicted MW | 16 kDa |
Protein Sequence |
>RC202688 protein sequence
Red=Cloning site Green=Tags(s) MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK S myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006324 |
RefSeq Size | 1207 |
RefSeq ORF | 423 |
Synonyms | hC1D; LRP1; Rrp47; SUN-CoR; SUNCOR |
Locus ID | 10438 |
UniProt ID | Q13901 |
Cytogenetics | 2p14 |
Summary | The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Alternate splicing results in multiple transcript variants that encode the same protein. Multiple pseudogenes of this gene are found on chromosome 10. [provided by RefSeq, Jun 2010] |
Protein Families | Druggable Genome |
Protein Pathways | RNA degradation |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406634 | C1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC416720 | C1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY406634 | Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 2 |
USD 325.00 |
|
LY416720 | Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 1 |
USD 325.00 |
|
PH303301 | C1D MS Standard C13 and N15-labeled recombinant protein (NP_775269) |
USD 2,055.00 |
|
TP302688 | Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 1 |
USD 823.00 |
|
TP303301 | Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review