FABP4 (NM_001442) Human Mass Spec Standard

CAT#: PH302702

FABP4 MS Standard C13 and N15-labeled recombinant protein (NP_001433)

Product Images

Coomassie blue staining of purified FABP4 protein (Cat# TP302702). The protein was produced from HEK293T cells transfected with FABP4 cDNA clone (Cat# RC202702) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202702
• Predicted MW: 14.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202702 representing NM_001442
  Red=Cloning site Green=Tags(s)
  
  MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQE
  FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001433
• RefSeq Size: 619
• RefSeq ORF: 396
• Synonyms: A-FABP; AFABP; ALBP; aP2; HEL-S-104
• Locus ID: 2167
• UniProt ID: P15090, E7DVW4
• Cytogenetics: 8q21.13
• Summary: 'FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: PPAR signaling pathway