GLP1 (GCG) (NM_002054) Human Mass Spec Standard

CAT#: PH302717

GCG MS Standard C13 and N15-labeled recombinant protein (NP_002045)

Product Images

Coomassie blue staining of purified GCG protein (Cat# TP302717). The protein was produced from HEK293T cells transfected with GCG cDNA clone (Cat# RC202717) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202717
• Predicted MW: 20.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202717 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRR
  AQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVE
  ELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002045
• RefSeq Size: 1294
• RefSeq ORF: 540
• Synonyms: GLP-1; GLP1; GLP2; GRPP
• Locus ID: 2641
• UniProt ID: P01275
• Cytogenetics: 2q24.2
• Summary: 'The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein