GLP1 (GCG) (NM_002054) Human Recombinant Protein
CAT#: TP302717
Purified recombinant protein of Homo sapiens glucagon (GCG)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202717 protein sequence
Red=Cloning site Green=Tags(s) MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRR AQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVE ELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002045 |
Locus ID | 2641 |
UniProt ID | P01275 |
Cytogenetics | 2q24.2 |
Refseq Size | 1294 |
Refseq ORF | 540 |
Synonyms | GLP-1; GLP1; GLP2; GRPP |
Summary | The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419562 | GCG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419562 | Transient overexpression lysate of glucagon (GCG) |
USD 396.00 |
|
PH302717 | GCG MS Standard C13 and N15-labeled recombinant protein (NP_002045) |
USD 2,055.00 |
|
TP720706 | Purified recombinant protein of Human glucagon (GCG) |
USD 330.00 |
|
TP723140 | Purified recombinant protein of Human glucagon (GCG). |
USD 140.00 |
{0} Product Review(s)
Be the first one to submit a review