FXYD2 (NM_021603) Human Mass Spec Standard
CAT#: PH302739
FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202739 |
Predicted MW | 7.4 kDa |
Protein Sequence |
>RC202739 protein sequence
Red=Cloning site Green=Tags(s) MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_067614 |
RefSeq Size | 591 |
RefSeq ORF | 192 |
Synonyms | ATP1G1; HOMG2 |
Locus ID | 486 |
UniProt ID | P54710 |
Cytogenetics | 11q23.3 |
Summary | 'This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]' |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411967 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC419804 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426799 | FXYD2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411967 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b |
USD 325.00 |
|
LY419804 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a |
USD 325.00 |
|
LY426799 | Transient overexpression lysate of FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c |
USD 325.00 |
|
PH305076 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001671) |
USD 2,055.00 |
|
PH325122 | FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_001120961) |
USD 2,055.00 |
|
TP302739 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant b |
USD 823.00 |
|
TP305076 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a |
USD 823.00 |
|
TP325122 | Recombinant protein of human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant c |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review