FXYD2 (NM_021603) Human Mass Spec Standard

CAT#: PH302739

FXYD2 MS Standard C13 and N15-labeled recombinant protein (NP_067614)

Product Images

Coomassie blue staining of purified FXYD2 protein (Cat# TP302739). The protein was produced from HEK293T cells transfected with FXYD2 cDNA clone (Cat# RC202739) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202739
• Predicted MW: 7.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202739 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067614
• RefSeq Size: 591
• RefSeq ORF: 192
• Synonyms: ATP1G1; HOMG2
• Locus ID: 486
• UniProt ID: P54710
• Cytogenetics: 11q23.3
• Summary: 'This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011]'
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane