Troponin C (TNNC2) (NM_003279) Human Mass Spec Standard

CAT#: PH302754

TNNC2 MS Standard C13 and N15-labeled recombinant protein (NP_003270)

Product Images

Coomassie blue staining of purified TNNC2 protein (Cat# TP302754). The protein was produced from HEK293T cells transfected with TNNC2 cDNA clone (Cat# RC202754) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202754
• Predicted MW: 18.1 kDa
• Protein Sequence:
  Sequence Link

  >RC202754 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGT
  IDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGD
  KNNDGRIDFDEFLKMMEGVQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003270
• RefSeq Size: 698
• RefSeq ORF: 480
• Synonyms: fast skeletal muscle troponin C; OTTHUMP00000039531; troponin C2, fast; troponin C type 2 (fast)
• Locus ID: 7125
• UniProt ID: P02585
• Cytogenetics: 20q13.12
• Summary: 'Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Calcium signaling pathway