CTRB1 (NM_001906) Human Mass Spec Standard

CAT#: PH302806

CTRB1 MS Standard C13 and N15-labeled recombinant protein (NP_001897)

Product Images

Coomassie blue staining of purified CTRB1 protein (Cat# TP302806). The protein was produced from HEK293T cells transfected with CTRB1 cDNA clone (Cat# RC202806) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202806
• Predicted MW: 27.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202806 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWV
  VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVC
  LPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCM
  GDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAAN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001897
• RefSeq Size: 873
• RefSeq ORF: 789
• Synonyms: CTRB
• Locus ID: 1504
• UniProt ID: P17538
• Cytogenetics: 16q23.1
• Summary: 'This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate a functional enzyme. This gene is located adjacent to a related chymotrypsinogen gene. This gene encodes distinct isoforms, some or all of which may undergo similar processing to generate the mature protein. [provided by RefSeq, Jul 2016]'
• Protein Families: Druggable Genome, Protease, Secreted Protein, Transmembrane