NQO2 (NM_000904) Human Mass Spec Standard

CAT#: PH302889

NQO2 MS Standard C13 and N15-labeled recombinant protein (NP_000895)

Product Images

Coomassie blue staining of purified NQO2 protein (Cat# TP302889). The protein was produced from HEK293T cells transfected with NQO2 cDNA clone (Cat# RC202889) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202889
• Predicted MW: 26 kDa
• Protein Sequence:
  Sequence Link

  >RC202889 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNFEPRATDKDITGTLSNPEVFNYGV
  ETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDIPGFYDSGLLQG
  KLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFCGFKVLAPQISFAPEIASEEERKGMVAAWSQ
  RLQTIWKEEPIPCTAHWHFGQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000895
• RefSeq Size: 1272
• RefSeq ORF: 693
• Synonyms: DHQV; DIA6; NMOR2; QR2
• Locus ID: 4835
• UniProt ID: P16083, B3KPX6
• Cytogenetics: 6p25.2
• Summary: 'This gene encodes a member of the thioredoxin family of enzymes. It is a cytosolic and ubiquitously expressed flavoprotein that catalyzes the two-electron reduction of quinone substrates and uses dihydronicotinamide riboside as a reducing coenzyme. Mutations in this gene have been associated with neurodegenerative diseases and several cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]'