NUDT3 (NM_006703) Human Mass Spec Standard

CAT#: PH302900

NUDT3 MS Standard C13 and N15-labeled recombinant protein (NP_006694)

Product Images

Coomassie blue staining of purified NUDT3 protein (Cat# TP302900). The protein was produced from HEK293T cells transfected with NUDT3 cDNA clone (Cat# RC202900) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202900
• Predicted MW: 19.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202900 representing NM_006703
  Red=Cloning site Green=Tags(s)
  
  MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEE
  AGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYF
  ETLRQGYSANNGTPVVATTYSVSAQSSMSGIR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006694
• RefSeq Size: 1371
• RefSeq ORF: 516
• Synonyms: DIPP; DIPP-1; DIPP1
• Locus ID: 11165
• UniProt ID: O95989
• Cytogenetics: 6p21.31
• Summary: NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]). [supplied by OMIM, Feb 2011]