NUDT3 (NM_006703) Human Recombinant Protein

CAT#: TP302900

Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 3 (NUDT3)

Product Images

Coomassie blue staining of purified NUDT3 protein (Cat# TP302900). The protein was produced from HEK293T cells transfected with NUDT3 cDNA clone (Cat# RC202900) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202900 representing NM_006703
  Red=Cloning site Green=Tags(s)
  
  MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEE
  AGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYF
  ETLRQGYSANNGTPVVATTYSVSAQSSMSGIR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006694
• Locus ID: 11165
• UniProt ID: O95989
• Cytogenetics: 6p21.31
• Refseq Size: 1371
• Refseq ORF: 516
• Synonyms: DIPP; DIPP-1; DIPP1
• Summary: NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM, Feb 2011]