PEX14 (NM_004565) Human Mass Spec Standard

CAT#: PH302903

PEX14 MS Standard C13 and N15-labeled recombinant protein (NP_004556)

Product Images

Coomassie blue staining of purified PEX14 protein (Cat# TP302903). The protein was produced from HEK293T cells transfected with PEX14 cDNA clone (Cat# RC202903) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202903
• Predicted MW: 41.2 kDa
• Protein Sequence:
  Sequence Link

  >RC202903 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQS
  GTAADEPSSLGPATQVVPVQPPHLISQPYSPAGSRWRDYGALAIIMAGIAFGFHQLYKKYLLPLILGGRE
  DRKQLERMEAGLSELSGSVAQTVTQLQTTLASVQELLIQQQQKIQELAHELAAAKATTSTNWILESQNIN
  ELKSEINSLKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSPGKEG
  HSPEGSTVTYHLLGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDR
  RGGDGQINEQVEKLRRPEGASNESERD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004556
• RefSeq Size: 1945
• RefSeq ORF: 1131
• Synonyms: dJ734G22.2; NAPP2; PBD13A; Pex14p
• Locus ID: 5195
• UniProt ID: O75381
• Cytogenetics: 1p36.22
• Summary: 'This gene encodes an essential component of the peroxisomal import machinery. The protein is integrated into peroxisome membranes with its C-terminus exposed to the cytosol, and interacts with the cytosolic receptor for proteins containing a PTS1 peroxisomal targeting signal. The protein also functions as a transcriptional corepressor and interacts with a histone deacetylase. A mutation in this gene results in one form of Zellweger syndrome. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome