ROR alpha (RORA) (NM_134261) Human Mass Spec Standard
CAT#: PH302926
RORA MS Standard C13 and N15-labeled recombinant protein (NP_599023)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202926 |
| Predicted MW | 58.8 kDa |
| Protein Sequence |
>RC202926 representing NM_134261
Red=Cloning site Green=Tags(s) MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEI IPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCQHCRLQKCLAVGMSR DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPE GSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNI SKSHLETCQYLREELQQITWQTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQN DQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMA FKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_599023 |
| RefSeq Size | 1847 |
| RefSeq ORF | 1569 |
| Synonyms | IDDECA; NR1F1; ROR1; ROR2; ROR3; RZR-ALPHA; RZRA |
| Locus ID | 6095 |
| UniProt ID | P35398 |
| Cytogenetics | 15q22.2 |
| Summary | 'The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014]' |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401041 | RORA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC403350 | RORA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC408623 | RORA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY401041 | Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 3 |
USD 605.00 |
|
| LY403350 | Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 1 |
USD 436.00 |
|
| LY408623 | Transient overexpression lysate of RAR-related orphan receptor A (RORA), transcript variant 4 |
USD 665.00 |
|
| TP302926 | Recombinant protein of human RAR-related orphan receptor A (RORA), transcript variant 1 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China