TACO1 (NM_016360) Human Mass Spec Standard

CAT#: PH302948

TACO1 MS Standard C13 and N15-labeled recombinant protein (NP_057444)

Product Images

Coomassie blue staining of purified TACO1 protein (Cat# TP302948). The protein was produced from HEK293T cells transfected with TACO1 cDNA clone (Cat# RC202948) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202948
• Predicted MW: 32.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202948 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAWAAASLSRAAARCLLARGPGVRAAPPRDPRPSHPEPRGCGAAPGRTLHFTAAVPAGHNKWSKVRHIK
  GPKDVERSRIFSKLCLNIRLAVKEGGPNPEHNSNLANILEVCRSKHMPKSTIETALKMEKSKDTYLLYEG
  RGPGGSSLLIEALSNSSHKCQADIRHILNKNGGVMAVGARHSFDKKGVIVVEVEDREKKAVNLERALEMA
  IEAGAEDVKETEDEEERNVFKFICDASSLHQVRKKLDSLGLCSVSCALEFIPNSKVQLAEPDLEQAAHLI
  QALSNHEDVIHVYDNIE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057444
• RefSeq Size: 1479
• RefSeq ORF: 891
• Synonyms: CCDC44
• Locus ID: 51204
• UniProt ID: Q9BSH4
• Cytogenetics: 17q23.3
• Summary: This gene encodes a mitochondrial protein that function as a translational activator of mitochondrially-encoded cytochrome c oxidase 1. Mutations in this gene are associated with Leigh syndrome. [provided by RefSeq, Mar 2010]