Germany
Japan
United Kingdom
China
TACO1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TACO1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TACO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TACO1 Antibody is: synthetic peptide directed towards the C-terminal region of Human TACO1. Synthetic peptide located within the following region: NLERALEMAIEAGAEDVKETEDEEERNVFKFICDASSLHQVRKKLDSLGL |
Rabbit Polyclonal Anti-Taco1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Taco1 Antibody is: synthetic peptide directed towards the middle region of Rat Taco1. Synthetic peptide located within the following region: AVAFAGHNKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNS |
TACO1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TACO1 |
TACO1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-297 of human TACO1 (NP_057444.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TACO1