PLA2G12A (NM_030821) Human Mass Spec Standard

CAT#: PH302955

PLA2G12A MS Standard C13 and N15-labeled recombinant protein (NP_110448)

Product Images

Coomassie blue staining of purified PLA2G12A protein (Cat# TP302955). The protein was produced from HEK293T cells transfected with PLA2G12A cDNA clone (Cat# RC202955) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202955
• Predicted MW: 20.9 kDa
• Protein Sequence:
  Sequence Link

  >RC202955 representing NM_030821
  Red=Cloning site Green=Tags(s)
  
  MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDG
  SKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQ
  KTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_110448
• RefSeq Size: 1699
• RefSeq ORF: 567
• Synonyms: GXII; PLA2G12; ROSSY
• Locus ID: 81579
• UniProt ID: Q9BZM1, Q542Y6
• Cytogenetics: 4q25
• Summary: Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s (Gelb et al., 2000 [PubMed 11031251]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway