QPRT (NM_014298) Human Mass Spec Standard

CAT#: PH302960

QPRT MS Standard C13 and N15-labeled recombinant protein (NP_055113)

Product Images

Coomassie blue staining of purified QPRT protein (Cat# TP302960). The protein was produced from HEK293T cells transfected with QPRT cDNA clone (Cat# RC202960) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202960
• Predicted MW: 30.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202960 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGILAGQPFFDAIFTQLNCQ
  VSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKT
  TPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFALKVEVECSSLQEAVQ
  AAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD
  FSLKLFAKEVAPVPKIH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055113
• RefSeq Size: 1575
• RefSeq ORF: 891
• Synonyms: HEL-S-90n; QPRTase
• Locus ID: 23475
• UniProt ID: Q15274, V9HWJ5, B4DDH4
• Cytogenetics: 16p11.2
• Summary: This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism