UFD1 (NM_005659) Human Mass Spec Standard

CAT#: PH302989

UFD1L MS Standard C13 and N15-labeled recombinant protein (NP_005650)

Product Images

Coomassie blue staining of purified UFD1 protein (Cat# TP302989). The protein was produced from HEK293T cells transfected with UFD1 cDNA clone (Cat# RC202989) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202989
• Predicted MW: 34.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202989 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLT
  NKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKA
  VLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST
  EGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKK
  VEEDEAGGRFVAFSGEGQSLRKKGRKP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005650
• RefSeq Size: 1783
• RefSeq ORF: 921
• Synonyms: UFD1L
• Locus ID: 7353
• UniProt ID: Q92890, Q541A5
• Cytogenetics: 22q11.21
• Summary: 'The protein encoded by this gene forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitinated proteins. In addition, this complex controls the disassembly of the mitotic spindle and the formation of a closed nuclear envelope after mitosis. Mutations in this gene have been associated with Catch 22 syndrome as well as cardiac and craniofacial defects. Alternative splicing results in multiple transcript variants encoding different isoforms. A related pseudogene has been identified on chromosome 18. [provided by RefSeq, Jun 2009]'