C1orf57 (NTPCR) (NM_032324) Human Mass Spec Standard

CAT#: PH303017

C1orf57 MS Standard C13 and N15-labeled recombinant protein (NP_115700)

Product Images

Coomassie blue staining of purified NTPCR protein (Cat# TP303017). The protein was produced from HEK293T cells transfected with NTPCR cDNA clone (Cat# RC203017) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203017
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203017 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPP
  PGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTII
  LGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115700
• RefSeq Size: 926
• RefSeq ORF: 570
• Synonyms: C1orf57; HCR-NTPase; THEP1
• Locus ID: 84284
• UniProt ID: Q9BSD7, Q5TDE9
• Cytogenetics: 1q42.2
• Summary: The protein encoded by this gene is a non-specific nucleoside triphosphatase that is slow-acting in vitro. This gene is overexpressed in many tumor tissues, and while it is not essential for the cell, overexpression is cytotoxic. However, the cytotoxicity is not related to its triphosphatase activity. [provided by RefSeq, Jul 2016]
• Protein Families: Protease