BCCIP (NM_078468) Human Mass Spec Standard
CAT#: PH303061
BCCIP MS Standard C13 and N15-labeled recombinant protein (NP_510868)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203061 |
Predicted MW | 36.1 kDa |
Protein Sequence |
>RC203061 protein sequence
Red=Cloning site Green=Tags(s) MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN KPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_510868 |
RefSeq Size | 1261 |
RefSeq ORF | 942 |
Synonyms | TOK-1; TOK1 |
Locus ID | 56647 |
UniProt ID | Q9P287 |
Cytogenetics | 10q26.2 |
Summary | This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409214 | BCCIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC409215 | BCCIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC413842 | BCCIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409214 | Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B |
USD 325.00 |
|
LY409215 | Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant C |
USD 325.00 |
|
LY413842 | Transient overexpression lysate of BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant A |
USD 325.00 |
|
TP303061 | Recombinant protein of human BRCA2 and CDKN1A interacting protein (BCCIP), transcript variant B |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review