GST3 (GSTP1) (NM_000852) Human Mass Spec Standard
CAT#: PH303086
GSTP1 MS Standard C13 and N15-labeled recombinant protein (NP_000843)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203086 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC203086 protein sequence
Red=Cloning site Green=Tags(s) MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTIL RHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGG KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000843 |
RefSeq Size | 986 |
RefSeq ORF | 630 |
Synonyms | DFN7; FAEES3; GST3; GSTP; HEL-S-22; PI |
Locus ID | 2950 |
UniProt ID | P09211, V9HWE9 |
Cytogenetics | 11q13.2 |
Summary | 'Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Pathways in cancer, Prostate cancer |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400300 | GSTP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400300 | Transient overexpression lysate of glutathione S-transferase pi 1 (GSTP1) |
USD 396.00 |
|
TP303086 | Recombinant protein of human glutathione S-transferase pi 1 (GSTP1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review