Myoglobin (MB) (NM_203378) Human Mass Spec Standard

CAT#: PH303113

MB MS Standard C13 and N15-labeled recombinant protein (NP_976312)

Product Images

Coomassie blue staining of purified MB protein (Cat# TP303113). The protein was produced from HEK293T cells transfected with MB cDNA clone (Cat# RC203113) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203113
• Predicted MW: 17.2 kDa
• Protein Sequence:
  Sequence Link

  >RC203113 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL
  TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR
  KDMASNYKELGFQG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_976312
• RefSeq Size: 1153
• RefSeq ORF: 462
• Synonyms: myoglobgin; PVALB
• Locus ID: 4151
• UniProt ID: P02144, A0A1K0FU49
• Cytogenetics: 22q12.3
• Summary: 'This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. [provided by RefSeq, May 2020]'