Tetranectin (CLEC3B) (NM_003278) Human Mass Spec Standard
CAT#: PH303128
CLEC3B MS Standard C13 and N15-labeled recombinant protein (NP_003269)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203128 |
Predicted MW | 22.6 kDa |
Protein Sequence |
>RC203128 protein sequence
Red=Cloning site Green=Tags(s) MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTV CLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAA EGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003269 |
RefSeq Size | 886 |
RefSeq ORF | 606 |
Synonyms | TN; TNA |
Locus ID | 7123 |
UniProt ID | P05452 |
Cytogenetics | 3p21.31 |
Summary | '' |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418793 | CLEC3B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418793 | Transient overexpression lysate of C-type lectin domain family 3, member B (CLEC3B) |
USD 396.00 |
|
TP303128 | Recombinant protein of human C-type lectin domain family 3, member B (CLEC3B) |
USD 439.00 |
|
TP720380 | Recombinant protein of human C-type lectin domain family 3, member B (CLEC3B) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review