Tetranectin (CLEC3B) (NM_003278) Human Recombinant Protein

CAT#: TP303128

Recombinant protein of human C-type lectin domain family 3, member B (CLEC3B)

Product Images

Coomassie blue staining of purified CLEC3B protein (Cat# TP303128). The protein was produced from HEK293T cells transfected with CLEC3B cDNA clone (Cat# RC203128) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203128 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTV
  CLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAA
  EGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003269
• Locus ID: 7123
• UniProt ID: P05452
• Cytogenetics: 3p21.31
• Refseq Size: 886
• Refseq ORF: 606
• Synonyms: TN; TNA
• Summary: Tetranectin binds to plasminogen and to isolated kringle 4. May be involved in the packaging of molecules destined for exocytosis.[UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein