BHMT (NM_001713) Human Mass Spec Standard

CAT#: PH303148

BHMT MS Standard C13 and N15-labeled recombinant protein (NP_001704)

Product Images

Coomassie blue staining of purified BHMT protein (Cat# TP303148). The protein was produced from HEK293T cells transfected with BHMT cDNA clone (Cat# RC203148) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203148
• Predicted MW: 45 kDa
• Protein Sequence:
  Sequence Link

  >RC203148 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNV
  MQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKV
  FLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGA
  SIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWD
  IQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKE
  YWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001704
• RefSeq Size: 2515
• RefSeq ORF: 1218
• Synonyms: BHMT1; HEL-S-61p
• Locus ID: 635
• UniProt ID: Q93088, V9HWA4
• Cytogenetics: 5q14.1
• Summary: 'This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Cysteine and methionine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways