BBOX1 (NM_003986) Human Mass Spec Standard

CAT#: PH303156

BBOX1 MS Standard C13 and N15-labeled recombinant protein (NP_003977)

Product Images

Coomassie blue staining of purified BBOX1 protein (Cat# TP303156). The protein was produced from HEK293T cells transfected with BBOX1 cDNA clone (Cat# RC203156) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203156
• Predicted MW: 44.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203156 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFD
  RKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKW
  LSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHH
  PPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIEL
  DDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRR
  SYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003977
• RefSeq Size: 1901
• RefSeq ORF: 1161
• Synonyms: BBH; BBOX; G-BBH; gamma-BBH
• Locus ID: 8424
• UniProt ID: O75936
• Cytogenetics: 11p14.2
• Summary: This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation. [provided by RefSeq, Jul 2008]
• Protein Pathways: Lysine degradation