MPZL (MPZL1) (NM_003953) Human Mass Spec Standard

CAT#: PH303176

MPZL1 MS Standard C13 and N15-labeled recombinant protein (NP_003944)

Product Images

Coomassie blue staining of purified MPZL1 protein (Cat# TP303176). The protein was produced from HEK293T cells transfected with MPZL1 cDNA clone (Cat# RC203176) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203176
• Predicted MW: 29.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203176 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLT
  SVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNP
  PDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLS
  PVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003944
• RefSeq Size: 5026
• RefSeq ORF: 807
• Synonyms: MPZL1b; PZR; PZR1b; PZRa; PZRb
• Locus ID: 9019
• UniProt ID: O95297, A8K5D4
• Cytogenetics: 1q24.2
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)