Cyclophilin B (PPIB) (NM_000942) Human Mass Spec Standard

CAT#: PH303180

PPIB MS Standard C13 and N15-labeled recombinant protein (NP_000933)

Product Images

Coomassie blue staining of purified PPIB protein (Cat# TP303180). The protein was produced from HEK293T cells transfected with PPIB cDNA clone (Cat# RC203180) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203180
• Predicted MW: 23.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203180 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVP
  KTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSM
  ANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKP
  FAIAKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000933
• RefSeq Size: 1045
• RefSeq ORF: 648
• Synonyms: B; CYP-S1; CYPB; HEL-S-39; OI9; SCYLP
• Locus ID: 5479
• UniProt ID: P23284
• Cytogenetics: 15q22.31
• Summary: 'The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta. [provided by RefSeq, Oct 2009]'
• Protein Families: Druggable Genome, Transmembrane