Cyclophilin B (PPIB) (NM_000942) Human Mass Spec Standard
CAT#: PH303180
PPIB MS Standard C13 and N15-labeled recombinant protein (NP_000933)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203180 |
Predicted MW | 23.7 kDa |
Protein Sequence |
>RC203180 protein sequence
Red=Cloning site Green=Tags(s) MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVP KTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSM ANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKP FAIAKE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000933 |
RefSeq Size | 1045 |
RefSeq ORF | 648 |
Synonyms | B; CYP-S1; CYPB; HEL-S-39; OI9; SCYLP |
Locus ID | 5479 |
UniProt ID | P23284 |
Cytogenetics | 15q22.31 |
Summary | 'The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta. [provided by RefSeq, Oct 2009]' |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424437 | PPIB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY424437 | Transient overexpression lysate of peptidylprolyl isomerase B (cyclophilin B) (PPIB) |
USD 396.00 |
|
TP303180 | Recombinant protein of human peptidylprolyl isomerase B (cyclophilin B) (PPIB) |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review