Cyclophilin B (PPIB) (NM_000942) Human Recombinant Protein

CAT#: TP303180

Recombinant protein of human peptidylprolyl isomerase B (cyclophilin B) (PPIB)

Product Images

Coomassie blue staining of purified PPIB protein (Cat# TP303180). The protein was produced from HEK293T cells transfected with PPIB cDNA clone (Cat# RC203180) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203180 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVP
  KTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSM
  ANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKP
  FAIAKE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000933
• Locus ID: 5479
• UniProt ID: P23284
• Cytogenetics: 15q22.31
• Refseq Size: 1045
• Refseq ORF: 648
• Synonyms: B; CYP-S1; CYPB; HEL-S-39; OI9; SCYLP
• Summary: The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Variants have been identified in this protein that give rise to recessive forms of osteogenesis imperfecta. [provided by RefSeq, Oct 2009]
• Protein Families: Druggable Genome, Transmembrane