EEF1D (NM_001960) Human Mass Spec Standard
CAT#: PH303202
EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001951)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203202 |
| Predicted MW | 71.4 kDa |
| Protein Sequence |
>RC203202 protein sequence
Red=Cloning site Green=Tags(s) MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGS RRDPRKSQDSRKPLQKKRKRSPKSGLGPADLALLGLSAERVWLDKSLFDQAESSYRQKLADVAAQAAWPP ALAPWGLCTHGNQVACHHVTWGIWVNKSSFDQAERAFVEWSQALLLAPEGSRRQGTPNTGQQVAVPDLAH QPSPPVNGQPPLGSLQALVREVWLEKPRYDAAERGFYEALFDGHPPGKVRLQERAGLAEGARRGRRDRRG RNILGNKRAGLRRADGEAPSALPYCYFLQKDAEAPWLSKPAYDSAECRHHAAEALRVAWCLEAASLSHRP GPRSGLSVSSLRPNRKMATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARAR ENIQKSLAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRA TAPQTQHVSPMRQVEPPAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVA KSSILLDVKPWDDETDMAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEIT KFEEHVQSVDIAAFNKI myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001951 |
| RefSeq Size | 1276 |
| RefSeq ORF | 1944 |
| Synonyms | EF-1D; EF1D; FP1047 |
| Locus ID | 1936 |
| UniProt ID | P29692 |
| Cytogenetics | 8q24.3 |
| Summary | 'This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.[provided by RefSeq, Aug 2010]' |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410171 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC419621 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427131 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427133 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427135 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429804 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY410171 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1 |
USD 665.00 |
|
| LY419621 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2 |
USD 436.00 |
|
| LY427131 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 3 |
USD 436.00 |
|
| LY427133 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5 |
USD 436.00 |
|
| LY427135 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 6 |
USD 436.00 |
|
| LY429804 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1 |
USD 396.00 |
|
| PH325386 | EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001123527) |
USD 2,055.00 |
|
| TP303202 | Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2 |
USD 867.00 |
|
| TP325386 | Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5 |
USD 748.00 |
|
| TP760795 | Purified recombinant protein of Human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China