Annexin IV (ANXA4) (NM_001153) Human Mass Spec Standard

CAT#: PH303229

ANXA4 MS Standard C13 and N15-labeled recombinant protein (NP_001144)

Product Images

Coomassie blue staining of purified ANXA4 protein (Cat# TP303229). The protein was produced from HEK293T cells transfected with ANXA4 cDNA clone (Cat# RC203229) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203229
• Predicted MW: 36.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203229 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDL
  KSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLED
  DIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHV
  FDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEI
  DMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001144
• RefSeq Size: 2158
• RefSeq ORF: 963
• Synonyms: ANX4; HEL-S-274; P32.5; PAP-II; PIG28; PP4-X; ZAP36
• Locus ID: 307
• UniProt ID: P09525, Q6P452, Q6LES2
• Cytogenetics: 2p13.3
• Summary: 'Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2016]'