Rabbit Polyclonal Anti-ANXA4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA4 |
Rabbit Polyclonal Anti-ANXA4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA4 |
Annexin IV (ANXA4) mouse monoclonal antibody, clone 1D3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Annexin IV (ANXA4) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rabbit, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human Annexin IV |
Rabbit Polyclonal Anti-ANXA4 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA4 antibody: synthetic peptide directed towards the N terminal of human ANXA4. Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ |
Rabbit Polyclonal Anti-ANXA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA4 antibody: synthetic peptide directed towards the middle region of human ANXA4. Synthetic peptide located within the following region: EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL |
Rabbit anti Annexin IV Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of human Annexin IV. This sequence is identical to human, mouse and rat. |
ANXA4 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA4 |
Annexin A4/Annexin IV Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 112-321 of human Annexin A4/Annexin IV (NP_001144.1). |
Modifications | Unmodified |
Annexin A4/Annexin IV Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 112-321 of human Annexin A4/Annexin IV (NP_001144.1). |
Modifications | Unmodified |
USD 523.00
2 Weeks
Recombinant Anti-ANXA4 (Clone SAIC-14C-10F12)
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |