Annexin IV (ANXA4) Rabbit Polyclonal Antibody

CAT#: TA341702

Rabbit Polyclonal Anti-ANXA4 Antibody

Product Images

WB Suggested Anti-ANXA4 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Placenta

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANXA4 antibody: synthetic peptide directed towards the N terminal of human ANXA4. Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: annexin A4
• Database Link:
  NP_001144
  Entrez Gene 79124 RatEntrez Gene 307 Human
  UniProt ID P09525
• Background: Annexin IV (ANX4) belongs toThe annexin family of calcium-dependent phospholipid binding proteins. AlthoughTheir functions are still not clearly defined, several members ofThe annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq, Jul 2008]
• Synonyms: ANX4; HEL-S-274; PIG28; ZAP36
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%; Zebrafish: 79%