LSM5 (NM_012322) Human Mass Spec Standard

CAT#: PH303266

LSM5 MS Standard C13 and N15-labeled recombinant protein (NP_036454)

Product Images

Coomassie blue staining of purified LSM5 protein (Cat# TP303266). The protein was produced from HEK293T cells transfected with LSM5 cDNA clone (Cat# RC203266) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203266
• Predicted MW: 9.9 kDa
• Protein Sequence:
  Sequence Link

  >RC203266 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLD
  QILLNGNNITMLVPGGEGPEV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036454
• RefSeq Size: 2275
• RefSeq ORF: 273
• Synonyms: YER146W
• Locus ID: 23658
• UniProt ID: Q9Y4Y9, A0A090N8Y5
• Cytogenetics: 7p14.3
• Summary: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing. [supplied by OMIM, Apr 2004]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation, Spliceosome