MAD2 (MAD2L1) (NM_002358) Human Mass Spec Standard

CAT#: PH303273

MAD2L1 MS Standard C13 and N15-labeled recombinant protein (NP_002349)

Product Images

Coomassie blue staining of purified MAD2L1 protein (Cat# TP303273). The protein was produced from HEK293T cells transfected with MAD2L1 cDNA clone (Cat# RC203273) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203273
• Predicted MW: 23.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203273 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVE
  QLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVT
  FLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002349
• RefSeq Size: 1453
• RefSeq ORF: 615
• Synonyms: HSMAD2; MAD2
• Locus ID: 4085
• UniProt ID: Q13257
• Cytogenetics: 4q27
• Summary: 'MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation