MAGEA3 (NM_005362) Human Mass Spec Standard

CAT#: PH303288

MAGEA3 MS Standard C13 and N15-labeled recombinant protein (NP_005353)

Product Images

Coomassie blue staining of purified MAGEA3 protein (Cat# TP303288). The protein was produced from HEK293T cells transfected with MAGEA3 cDNA clone (Cat# RC203288) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203288
• Predicted MW: 34.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203288 representing NM_005362
  Red=Cloning site Green=Tags(s)
  
  MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS
  LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVV
  GNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIA
  REGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVE
  TSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005353
• RefSeq Size: 1753
• RefSeq ORF: 942
• Synonyms: CT1.3; HIP8; HYPD; MAGE3; MAGEA6
• Locus ID: 4102
• UniProt ID: P43357
• Cytogenetics: Xq28
• Summary: 'This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq, Jul 2008]'