Ferritin Light Chain (FTL) (NM_000146) Human Mass Spec Standard
CAT#: PH303296
FTL MS Standard C13 and N15-labeled recombinant protein (NP_000137)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203296 |
| Predicted MW | 20 kDa |
| Protein Sequence |
>RC203296 protein sequence
Red=Cloning site Green=Tags(s) MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQ NQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVK LIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000137 |
| RefSeq Size | 889 |
| RefSeq ORF | 525 |
| Synonyms | LFTD; NBIA3 |
| Locus ID | 2512 |
| UniProt ID | P02792, A0A384MDR3 |
| Cytogenetics | 19q13.33 |
| Summary | 'This gene encodes the light subunit of the ferritin protein. Ferritin is the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in this light chain ferritin gene are associated with several neurodegenerative diseases and hyperferritinemia-cataract syndrome. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400051 | FTL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400051 | Transient overexpression lysate of ferritin, light polypeptide (FTL) |
USD 436.00 |
|
| TP303296 | Recombinant protein of human ferritin, light polypeptide (FTL) |
USD 823.00 |
|
| TP721181 | Purified recombinant protein of Human ferritin, light polypeptide (FTL) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China