Cyclophilin A (PPIA) (NM_021130) Human Mass Spec Standard
CAT#: PH303307
PPIA MS Standard C13 and N15-labeled recombinant protein (NP_066953)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203307 |
| Predicted MW | 18 kDa |
| Protein Sequence |
>RC203307 protein sequence
Red=Cloning site Green=Tags(s) MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH NGTGGKSIYGEKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE AMERFGSRNGKTSKKITIADCGQLE myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_066953 |
| RefSeq Size | 2288 |
| RefSeq ORF | 495 |
| Synonyms | CYPA; CYPH; HEL-S-69p |
| Locus ID | 5478 |
| UniProt ID | P62937, V9HWF5 |
| Cytogenetics | 7p13 |
| Summary | 'This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq, Jul 2008]' |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402839 | PPIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402839 | Transient overexpression lysate of peptidylprolyl isomerase A (cyclophilin A) (PPIA) |
USD 436.00 |
|
| TP303307 | Recombinant protein of human peptidylprolyl isomerase A (cyclophilin A) (PPIA) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China