Peroxiredoxin 4 (PRDX4) (NM_006406) Human Mass Spec Standard

CAT#: PH303330

PRDX4 MS Standard C13 and N15-labeled recombinant protein (NP_006397)

Product Images

Coomassie blue staining of purified PRDX4 protein (Cat# TP303330). The protein was produced from HEK293T cells transfected with PRDX4 cDNA clone (Cat# RC203330) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203330
• Predicted MW: 30.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203330 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVA
  DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRS
  INTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGI
  LRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006397
• RefSeq Size: 921
• RefSeq ORF: 813
• Synonyms: AOE37-2; AOE372; HEL-S-97n; PRX-4
• Locus ID: 10549
• UniProt ID: Q13162, V9HW63
• Cytogenetics: Xp22.11
• Summary: The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome