ZFYVE21 (NM_024071) Human Mass Spec Standard

CAT#: PH303337

ZFYVE21 MS Standard C13 and N15-labeled recombinant protein (NP_076976)

Product Images

Coomassie blue staining of purified ZFYVE21 protein (Cat# TP303337). The protein was produced from HEK293T cells transfected with ZFYVE21 cDNA clone (Cat# RC203337) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203337
• Predicted MW: 26.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203337 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSEVSARRDAKKLVRSPSGLRMVPEHRAFGSPFGLEEPQWVPDKECRRCMQCDAKFDFLTRKHHCRRCG
  KCFCDRCCSQKVPLRRMCFVDPVRQCAECALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRL
  SNNQRYLFLDGDSHYEIEIVHISTVQILTEGFPPGGGNARATGMFLQYTVPGTEGVTQLKLTVVEDVTVG
  RRQAVAWLVAMHKAAKLLYESRDQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076976
• RefSeq Size: 1470
• RefSeq ORF: 702
• Synonyms: HCVP7TP1; ZF21
• Locus ID: 79038
• UniProt ID: Q9BQ24
• Cytogenetics: 14q32.33
• Summary: Plays a role in cell adhesion, and thereby in cell motility which requires repeated formation and disassembly of focal adhesions. Regulates microtubule-induced PTK2/FAK1 dephosphorylation, an event important for focal adhesion disassembly, as well as integrin beta-1/ITGB1 cell surface expression. [UniProtKB/Swiss-Prot Function]