ASAM (CLMP) (NM_024769) Human Mass Spec Standard
CAT#: PH303362
ASAM MS Standard C13 and N15-labeled recombinant protein (NP_079045)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203362 |
Predicted MW | 41.3 kDa |
Protein Sequence |
>RC203362 protein sequence
Red=Cloning site Green=Tags(s) MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRH VYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELE GELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTA GNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAP KARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHH ANLTKAETTPSMIPSQSRAFQTV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079045 |
RefSeq Size | 2645 |
RefSeq ORF | 1119 |
Synonyms | ACAM; ASAM; CSBM; CSBS |
Locus ID | 79827 |
UniProt ID | Q9H6B4, B4E3S3 |
Cytogenetics | 11q24.1 |
Summary | This gene encodes a type I transmembrane protein that is localized to junctional complexes between endothelial and epithelial cells and may have a role in cell-cell adhesion. Expression of this gene in white adipose tissue is implicated in adipocyte maturation and development of obesity. This gene is also essential for normal intestinal development and mutations in the gene are associated with congenital short bowel syndrome. [provided by RefSeq, Aug 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411081 | CLMP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411081 | Transient overexpression lysate of adipocyte-specific adhesion molecule (ASAM) |
USD 396.00 |
|
TP303362 | Recombinant protein of human adipocyte-specific adhesion molecule (ASAM) |
USD 439.00 |
|
TP720361 | Recombinant protein of human adipocyte-specific adhesion molecule (ASAM) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review