ASAM (CLMP) (NM_024769) Human Recombinant Protein
CAT#: TP303362
Recombinant protein of human adipocyte-specific adhesion molecule (ASAM)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203362 protein sequence
Red=Cloning site Green=Tags(s) MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRH VYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELE GELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTA GNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAP KARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHH ANLTKAETTPSMIPSQSRAFQTV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079045 |
Locus ID | 79827 |
UniProt ID | Q9H6B4, B4E3S3 |
Cytogenetics | 11q24.1 |
Refseq Size | 2645 |
Refseq ORF | 1119 |
Synonyms | ACAM; ASAM; CSBM; CSBS |
Summary | This gene encodes a type I transmembrane protein that is localized to junctional complexes between endothelial and epithelial cells and may have a role in cell-cell adhesion. Expression of this gene in white adipose tissue is implicated in adipocyte maturation and development of obesity. This gene is also essential for normal intestinal development and mutations in the gene are associated with congenital short bowel syndrome. [provided by RefSeq, Aug 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411081 | CLMP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411081 | Transient overexpression lysate of adipocyte-specific adhesion molecule (ASAM) |
USD 325.00 |
|
PH303362 | ASAM MS Standard C13 and N15-labeled recombinant protein (NP_079045) |
USD 2,055.00 |
|
TP720361 | Recombinant protein of human adipocyte-specific adhesion molecule (ASAM) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review