XLF (NHEJ1) (NM_024782) Human Mass Spec Standard

CAT#: PH303393

NHEJ1 MS Standard C13 and N15-labeled recombinant protein (NP_079058)

Product Images

Coomassie blue staining of purified NHEJ1 protein (Cat# TP303393). The protein was produced from HEK293T cells transfected with NHEJ1 cDNA clone (Cat# RC203393) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203393
• Predicted MW: 33.3 kDa
• Protein Sequence:
  Sequence Link

  >RC203393 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPA
  AFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLM
  GMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPF
  VMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGP
  LQRPQLSKVKRKKPRGLFS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079058
• RefSeq Size: 2119
• RefSeq ORF: 897
• Synonyms: XLF
• Locus ID: 79840
• UniProt ID: Q9H9Q4
• Cytogenetics: 2q35
• Summary: Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders. [provided by RefSeq, Jul 2008]
• Protein Pathways: Non-homologous end-joining